DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP012428

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_001688571.1 Gene:AgaP_AGAP012428 / 5668381 VectorBaseID:AGAP012428 Length:279 Species:Anopheles gambiae


Alignment Length:256 Identity:63/256 - (24%)
Similarity:110/256 - (42%) Gaps:69/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 VANG---SYQPGMEPKRQ--RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWF 414
            :.||   |...|:..|::  |||:|.||:..|||.|...:||:.:.|:|:|:.|.||:.|:|.|:
Mosquito     9 IKNGLGLSSSSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLGLSDTQVKTWY 73

  Fly   415 QNRRMKWKKDNKLPNTKNVRKKTVDANGN-------------------PTPVAKKPTKRAASKKQ 460
            ||||.|||:...      |..:.:...||                   |||.....|.::|....
Mosquito    74 QNRRTKWKRQTA------VGLELLAEAGNYAAFQRLYGGPPYIGAWPYPTPSGPPGTSQSAVDAY 132

  Fly   461 QQ-----AQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAP--ETTSSY--- 515
            .:     |..|:....:.....|         ::.::..:|...|..|::.|:.  .|.|||   
Mosquito   133 YRHAAAAAALQKPLPYRMYPGVP---------TIGTLNPISGPSGPFPHLSASSSLSTLSSYYQA 188

  Fly   516 -------------------PGSQQHLSNNNNNGSGNNNN-NNNNNNSNLNNNNNNNQMGHT 556
                               .||.|......:.|:|:.:: :|.|:.::::|::.|:|:.|:
Mosquito   189 NCGQQPAGSLLQQPHQTPSGGSNQLRDGETSVGAGSQHDISNLNSLTSISNHSLNSQIRHS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)
AgaP_AGAP012428XP_001688571.1 Homeobox 29..81 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.