DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP005041

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_001688472.1 Gene:AgaP_AGAP005041 / 5667286 VectorBaseID:AGAP005041 Length:263 Species:Anopheles gambiae


Alignment Length:209 Identity:63/209 - (30%)
Similarity:92/209 - (44%) Gaps:70/209 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTK 431
            :|.|||:|..|:|||||:|..::||:|.:|.|:|:.|:|||.|:||||||||||||:..|:..  
Mosquito    13 RRPRTAFTSQQLLELEKQFKVSKYLSRPKRYEVANNLLLSETQVKIWFQNRRMKWKRSRKVNE-- 75

  Fly   432 NVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVS 496
                                     |||.........|....|                      
Mosquito    76 -------------------------SKKYSNNSNNSGSNNNNT---------------------- 93

  Fly   497 SSLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGS--GNNNNNNNNNN-----SNLNNNNNNNQMG 554
                          ||::...|....||::.|||  |:|:|.:|::|     ||:|:.:|....|
Mosquito    94 --------------TTTNSSSSSSSSSNSSTNGSSTGSNSNISNHSNGPLGSSNVNSAHNGGGTG 144

  Fly   555 HTNLHGHLQQQQSD 568
            .:.|||...:..:|
Mosquito   145 GSLLHGSGNKTSTD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 32/51 (63%)
AgaP_AGAP005041XP_001688472.1 Homeobox 15..68 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.