DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and AgaP_AGAP000858

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_001688966.2 Gene:AgaP_AGAP000858 / 5666764 VectorBaseID:AGAP000858 Length:692 Species:Anopheles gambiae


Alignment Length:243 Identity:57/243 - (23%)
Similarity:90/243 - (37%) Gaps:80/243 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 RQRTAYTRH------------------------QILELEKEFHYNRYLTRRRRIEIAHTLVLSER 408
            |.||::|:.                        |:.|||:.|....|.....|.|:|..:.|:|.
Mosquito    85 RHRTSWTQGRLNPVLYASGILLVRRDEAKAAPLQLQELERAFQRTHYPDVFFREELAVRIDLTEA 149

  Fly   409 QIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQ 473
            ::::||||||.||:|.         .|.|....|...|                   .|..|...
Mosquito   150 RVQVWFQNRRAKWRKS---------EKTTGGGPGGGDP-------------------DQDGQDVL 186

  Fly   474 TQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNNN----------- 527
            :..|.....|.|:|.....|.:...:|  ..:.||..|     ||.:.|:::.:           
Mosquito   187 STSTGAATTCPRADGTGDTGLLGDEVG--LLVDAADAT-----GSSRMLNDDEDDDGLGLSDEVL 244

  Fly   528 NGSGNNNNNNNNNNS---------NLNNNNNNNQMGHTNLHGHLQQQQ 566
            :|.|....:.:::.:         :||:..:..|.|| :||.||||||
Mosquito   245 HGMGGGLKSQHHSQAVASLGGLGKSLNDAMSGEQAGH-HLHHHLQQQQ 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 21/75 (28%)
AgaP_AGAP000858XP_001688966.2 Homeobox 116..163 CDD:278475 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.