powered by:
Protein Alignment Dfd and gsx2
DIOPT Version :9
Sequence 1: | NP_477201.1 |
Gene: | Dfd / 40832 |
FlyBaseID: | FBgn0000439 |
Length: | 586 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001020683.1 |
Gene: | gsx2 / 561076 |
ZFINID: | ZDB-GENE-041001-114 |
Length: | 242 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 43/70 - (61%) |
Similarity: | 51/70 - (72%) |
Gaps: | 3/70 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 357 NGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKW 421
|...|.| ||.|||:|..|:||||:||..|.||:|.||||||..|.|||:|:||||||||:|.
Zfish 134 NSHIQNG---KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKH 195
Fly 422 KKDNK 426
||:.|
Zfish 196 KKEGK 200
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.