DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and meox2a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_017206696.1 Gene:meox2a / 556898 ZFINID:ZDB-GENE-080613-1 Length:302 Species:Danio rerio


Alignment Length:375 Identity:95/375 - (25%)
Similarity:131/375 - (34%) Gaps:147/375 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PHSMHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNS-----AISGHHQASAGGYSSNYANATP 136
            |.::|||      .|.|..|     .|..|.|...|:|     .:||:.....|.:..:....:.
Zfish    16 PQAVHPA------FALHGRP-----EHLSSYPDLSSSSPPSTCIVSGYPGEDGGLFGGHQRGLSV 69

  Fly   137 PSHPHSHPHAHPH--QSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLG 199
            ....|.|.|.|.|  |..|:   |.|:..||           .|:|             :|..||
Zfish    70 SQQQHHHHHHHHHLAQQGGW---HLPQSSSA-----------SPSA-------------AGVRLG 107

  Fly   200 GGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGL 264
            .|..|..:.....|.||                          |..|:||     .:||      
Zfish   108 LGISGPDSGSSDVGPGG--------------------------PSLCAST-----PSLG------ 135

  Fly   265 KLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSD 329
                   ..||:|......|      |.|......:|.::....|..|...|.|           
Zfish   136 -------AGVPSGASCVPGG------DFGRHTMSPAEAEKRNSKRRSDSSESQD----------- 176

  Fly   330 EDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGM--EPKRQRTAYTRHQILELEKEFHYNRYLT 392
                                        |:|:..:  :|:::|||:|:.||.|||.||.::.|||
Zfish   177 ----------------------------GNYKSDVSSKPRKERTAFTKEQIRELEAEFAHHNYLT 213

  Fly   393 RRRRIEIAHTLVLSERQIKIWFQNRRMKWK-----------KDNKLPNTK 431
            |.||.|||..|.|:|||:|:||||||||||           ::.:|.|.|
Zfish   214 RLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAVAREKELVNVK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
meox2aXP_017206696.1 COG5576 161..267 CDD:227863 46/142 (32%)
Homeobox 191..243 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.