DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and nkx3-1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001373254.1 Gene:nkx3-1 / 555375 ZFINID:ZDB-GENE-081104-238 Length:185 Species:Danio rerio


Alignment Length:138 Identity:47/138 - (34%)
Similarity:67/138 - (48%) Gaps:18/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 MGSENDDMSE---EDRLML---DRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKI 350
            |.:.|..::.   ||.|.|   .:..|...:..:.||..|..:|......|::|        |.:
Zfish     1 MATSNKQLTSFFIEDILSLKEDKKDEDSCNAESDRDDSTDRQTDSADTCRTSEG--------KTV 57

  Fly   351 HVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQ 415
            ....:..|    |.:.||.|.|:|..|:|||||:|...|||:...|..:|..|.|:|.|:|||||
Zfish    58 SSTEMTGG----GGKKKRSRAAFTHLQVLELEKKFSRQRYLSAPERTHLASALHLTETQVKIWFQ 118

  Fly   416 NRRMKWKK 423
            |||.|.|:
Zfish   119 NRRYKTKR 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 28/51 (55%)
nkx3-1NP_001373254.1 COG5576 15..>136 CDD:227863 44/124 (35%)
Homeobox 72..126 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.