DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and barhl1b

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001018142.1 Gene:barhl1b / 553186 ZFINID:ZDB-GENE-060118-2 Length:323 Species:Danio rerio


Alignment Length:212 Identity:60/212 - (28%)
Similarity:93/212 - (43%) Gaps:44/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SPHSQMMDLPLQCSSTEPPTNTAL--GLQELG--LKLEKRIEEA-VPAGQQ-------------L 280
            ||.|   ||...|||...|....:  ..|..|  |.....::.. :.||.|             |
Zfish    42 SPRS---DLESGCSSPPSPRRECVEDAAQRQGHPLAYASHLQHGPISAGSQPRTVASSFLIRDIL 103

  Fly   281 QELGMRLRCDDMGSENDDMSEEDRL---MLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERI 342
            .:......|....|......|..||   :.|...:::.||.:      |||:..:..|   |:|.
Zfish   104 ADCKPLAACAPYSSNGQPTQEAGRLASKIADDLIEKIHSNSS------SDSEYKVKEE---GDRE 159

  Fly   343 IYPWMKKIHVAGVANGSYQPGM-EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLS 406
            |          ..:..|.|..: :|::.|||:|.||:.:||:.|...:||:.:.|:|:|.:|.|:
Zfish   160 I----------SSSRDSPQVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLT 214

  Fly   407 ERQIKIWFQNRRMKWKK 423
            :.|:|.|:||||.|||:
Zfish   215 DTQVKTWYQNRRTKWKR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 24/51 (47%)
barhl1bNP_001018142.1 Oxidoreductase_nitrogenase 48..>88 CDD:295466 8/39 (21%)
Homeobox 178..230 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.