DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and barhl1a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001017712.2 Gene:barhl1a / 550407 ZFINID:ZDB-GENE-050417-212 Length:299 Species:Danio rerio


Alignment Length:206 Identity:55/206 - (26%)
Similarity:88/206 - (42%) Gaps:45/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SPHSQMMDLPLQCSSTEPPTNT-----------ALGLQE-LGLKLEKR-IEEAVPAGQQLQELGM 285
            ||.|   ||...|||...|..:           ||||.. |.:..:.| :..:......|.:...
Zfish    36 SPRS---DLDSGCSSPPSPRRSSVEDAVQRRARALGLDSPLQISQQPRTVTSSFLIRDILADCKP 97

  Fly   286 RLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKI 350
            ...|....|......:.:..|     |:|.||.:.|       .|..:.:..|.|          
Zfish    98 LAACAPYSSTGQSAQDAEDCM-----DKLHSNSSSD-------SEYRVKDEADRE---------- 140

  Fly   351 HVAGVANGSYQPG---MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKI 412
                :::....|.   .:|::.|||:|.||:.:||:.|...:||:.:.|:|:|.:|.|::.|:|.
Zfish   141 ----ISSSRDSPNSRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKT 201

  Fly   413 WFQNRRMKWKK 423
            |:||||.|||:
Zfish   202 WYQNRRTKWKR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 24/51 (47%)
barhl1aNP_001017712.2 TPP_enzymes <122..177 CDD:294952 17/75 (23%)
Homeobox 159..211 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.