DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxd1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001016678.1 Gene:hoxd1 / 549432 XenbaseID:XB-GENE-482731 Length:301 Species:Xenopus tropicalis


Alignment Length:367 Identity:92/367 - (25%)
Similarity:127/367 - (34%) Gaps:133/367 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 MTGHPHSMHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANATPP 137
            ||..|:....||  ..:|.....|.|.:|..:|..|             |.....|.:.|...||
 Frog    28 MTLQPYPGSGAD--HPFMPVGGVPGSVAHQASHQSP-------------ALYAPCSLDVAYEPPP 77

  Fly   138 SHPHSHPHAHPHQSLGYYVHHAPEFISAGAVH-SDPTNGYGPAANVPNTSNGGGGGGSGAVLGGG 201
              |..:...|......||          |:.| .:.|.|:.|                       
 Frog    78 --PSDYSFLHSSTDYDYY----------GSNHLVEETGGHIP----------------------- 107

  Fly   202 AVGGSANGYYGGYGGGYGTANGSV---GSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALG--LQE 261
                        ||......|||.   |....:.....:||..: .||   :.|.....|  ||.
 Frog   108 ------------YGSSVFPGNGSYILNGQLSYRTLGEETQMAQI-AQC---KEPLEVYPGGNLQS 156

  Fly   262 LGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDS 326
            :........:.|.||                  .:..:|..|.:.:.|:|.:             
 Frog   157 ISPSPGTYPKPASPA------------------SDTHVSTFDWMKVKRNPPK------------- 190

  Fly   327 DSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYL 391
               :.|.:|                 .|||:       .|...||.:|..|:.|||||||:|:||
 Frog   191 ---KSLQSE-----------------YGVAS-------PPCTVRTNFTTKQLTELEKEFHFNKYL 228

  Fly   392 TRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK---DNKLPNT 430
            ||.||||||::|.|::.|:||||||||||.||   :..|||:
 Frog   229 TRARRIEIANSLQLNDTQVKIWFQNRRMKQKKREREGSLPNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
hoxd1NP_001016678.1 Antp-type hexapeptide. /evidence=ECO:0000255 178..183 1/4 (25%)
Homeobox 207..260 CDD:365835 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..301 8/16 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4611
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.