DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and otx2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_012823826.1 Gene:otx2 / 548931 XenbaseID:XB-GENE-485220 Length:306 Species:Xenopus tropicalis


Alignment Length:275 Identity:64/275 - (23%)
Similarity:110/275 - (40%) Gaps:51/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 TTDGERIIYP---WMKKIHVA-GVANGSYQPGMEP---KRQRTAYTRHQILELEKEFHYNRYLTR 393
            ||.|..:::|   :...:|.: .:....|.....|   :|:||.:||.|:..||..|...||...
 Frog    18 TTSGMDLLHPSVGYPVALHQSRQITCSFYDFAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDI 82

  Fly   394 RRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASK 458
            ..|.|:|..:.|.|.::::||:|||.|.:           :::....||....|  :|:|    |
 Frog    83 FMREEVALKINLPESRVQVWFKNRRAKCR-----------QQQQQQQNGGQNKV--RPSK----K 130

  Fly   459 KQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIP--AAPETTS------SY 515
            |...|::.........|.:|   .|..|..:.|......|:.:|..|.  :.|.:||      ||
 Frog   131 KPSPAREVSSESGTSGQFSP---PCSTSVPVISSSTAPVSIWSPASISPLSDPLSTSSSCMQRSY 192

  Fly   516 PGSQQHLSNNNNNGSGNNNN-NNNNNNSNLNNNNNN--------NQMGHTNLHGHLQQQQSDLMT 571
            |.:....|..:...:|:.:. ...:..|.|...::.        :.||...:..||.|..:.|.:
 Frog   193 PMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLSGAGATLSPMGTNAVTSHLNQSPAALSS 257

  Fly   572 NLQLHIKQDYDLTAL 586
                   |.|..::|
 Frog   258 -------QAYGASSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 21/51 (41%)
otx2XP_012823826.1 Homeobox 59..111 CDD:365835 21/51 (41%)
TF_Otx 170..251 CDD:367546 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.