DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and crx

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001016021.1 Gene:crx / 548775 XenbaseID:XB-GENE-478452 Length:290 Species:Xenopus tropicalis


Alignment Length:171 Identity:43/171 - (25%)
Similarity:66/171 - (38%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTK 431
            :|:||.:||.|:..||..|...||.....|.|:|..:.|.|.::::||:|||.|.::        
 Frog    39 RRERTTFTRAQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ-------- 95

  Fly   432 NVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSD-----SLES 491
              :::.......|.|..||.:....:..:.....|.......|..||.........     |:..
 Frog    96 --QQQQSTGQAKPRPAKKKTSPARETNSEASTNGQYSPPPPGTAVTPSSTASATVSIWSPASISP 158

  Fly   492 IGD---------VSSSLGNPPYIPAAPETTSSYPGSQQHLS 523
            |.|         :..|.|.|.....||..|.||.||..:.:
 Frog   159 IPDPLSAATTPCMQRSAGYPMTYSQAPAYTQSYGGSSSYFT 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 21/51 (41%)
crxNP_001016021.1 Homeobox 42..94 CDD:395001 21/51 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..144 8/60 (13%)
TF_Otx 154..236 CDD:397546 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.