DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001015971.1 Gene:hoxb3 / 548725 XenbaseID:XB-GENE-482576 Length:386 Species:Xenopus tropicalis


Alignment Length:382 Identity:111/382 - (29%)
Similarity:144/382 - (37%) Gaps:114/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 GGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQL 280
            |||....||:|....|...|.|..||...|.||        ..||.||           .:|..:
 Frog    14 GGYPYQAGSLGYEGPQQSFPTSSHMDNEFQRSS--------CSLQSLG-----------HSGPLV 59

  Fly   281 QELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDL--------MAETT 337
            :...:...|     ...::|.|....|..:.:. .||.|     .|.|...|        .|..:
 Frog    60 KAKNLNGSC-----MRPNLSSEQSQPLSPTANP-SSNTN-----SSSSQASLSKPSPAKSQASGS 113

  Fly   338 DGERIIYPWMKKIH------------VAGVANGSYQP--GMEPKRQRTAYTRHQILELEKEFHYN 388
            ...:.|:||||:..            .|....|...|  ....||.|||||..|::|||||||:|
 Frog   114 PASKQIFPWMKESRQNSKQKSSPPAPAAESCGGDRSPPGSSASKRARTAYTSAQLVELEKEFHFN 178

  Fly   389 RYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTK 453
            |||.|.||:|:|:.|.||||||||||||||||:|||.|:       |....::|..:|.:..|..
 Frog   179 RYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKV-------KGMSSSSGGASPTSTPPLS 236

  Fly   454 RAAS-----------------------KKQQQAQQQQQSQQQQTQQTPVMNECIRSD--SLESIG 493
            ..:|                       |..|.|..|...:...:|| ...|.....|  .|:..|
 Frog   237 MQSSAGFLGSMHSMTANYEAPSPPPFNKSHQNAYYQNPGKGCPSQQ-KYGNTAAEYDHHGLQGNG 300

  Fly   494 D--VSSSL-GNPPY--------IPAA------------PETTSSY------PGSQQH 521
            .  ||.:: |:|.|        :||.            ..|...|      |.||.|
 Frog   301 GAYVSPNMQGSPVYVGGNYVDSVPAQGPPLYGLNHLAHQPTNMDYNGAPPMPASQHH 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 39/51 (76%)
hoxb3NP_001015971.1 Homeobox 160..212 CDD:306543 39/51 (76%)
DUF4074 325..384 CDD:315871 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.