DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001116487.1 Gene:hoxb4 / 548393 XenbaseID:XB-GENE-1033882 Length:234 Species:Xenopus tropicalis


Alignment Length:321 Identity:105/321 - (32%)
Similarity:132/321 - (41%) Gaps:109/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SSNYANAT-PPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGG 191
            ||||.:.. ||...:||....|.       .|:||:.                         ||.
 Frog     9 SSNYVDPKFPPCEEYSHTDYLPS-------GHSPEYY-------------------------GGQ 41

  Fly   192 GGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTA 256
            ....:...|.....|.:.....|....|:........||.|..| .:...|....:.|.||:   
 Frog    42 KRESSFQHGAPYSRSLSSSSAPYTSCQGSVRQGARLPHSSGLLP-GEKAHLESSITPTSPPS--- 102

  Fly   257 LGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDD 321
                                            |..:.|::            :.||..|.     
 Frog   103 --------------------------------CSLIASDH------------KHPDSPGQ----- 118

  Fly   322 DLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFH 386
                              :.::||||||.|::. |:.:|..| |.||.||||||.|:||||||||
 Frog   119 ------------------DPVVYPWMKKAHISR-ASSTYSDG-EAKRSRTAYTRQQVLELEKEFH 163

  Fly   387 YNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVD---ANGNP 444
            ||||||||||:||||||.||||||||||||||||||||:||||||.....:|:   |.|:|
 Frog   164 YNRYLTRRRRVEIAHTLRLSERQIKIWFQNRRMKWKKDHKLPNTKIRSNPSVNLQIAGGSP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 47/51 (92%)
hoxb4NP_001116487.1 Homeobox 146..200 CDD:365835 48/53 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6065
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm47668
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4536
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.