DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and PRRX2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_057391.1 Gene:PRRX2 / 51450 HGNCID:21338 Length:253 Species:Homo sapiens


Alignment Length:221 Identity:52/221 - (23%)
Similarity:76/221 - (34%) Gaps:66/221 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 PPTNTALGLQELGLKLEKR--------IEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLML 307
            ||...|||..:.. :..|.        :||...||:.....|.|              .|.|...
Human    20 PPPPPALGPGDCA-QARKNFSVSHLLDLEEVAAAGRLAARPGAR--------------AEAREGA 69

  Fly   308 DRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPG--------M 364
            .|.|.           |.|...|   |...|||                  ...||        .
Human    70 AREPS-----------GGSSGSE---AAPQDGE------------------CPSPGRGSAAKRKK 102

  Fly   365 EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK--- 426
            :.:|.||.:...|:..||:.|....|.....|.|:|..:.|||.::::||||||.|::::.:   
Human   103 KQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAML 167

  Fly   427 LPNTKNVRKKTVDANGNPTPVAKKPT 452
            ...:.::.|..........|||.:||
Human   168 ASRSASLLKSYSQEAAIEQPVAPRPT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/51 (39%)
PRRX2NP_057391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 5/13 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..113 18/103 (17%)
Homeobox 109..161 CDD:395001 19/51 (37%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 230..243
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.