powered by:
Protein Alignment Dfd and PAX4
DIOPT Version :9
Sequence 1: | NP_477201.1 |
Gene: | Dfd / 40832 |
FlyBaseID: | FBgn0000439 |
Length: | 586 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001353039.1 |
Gene: | PAX4 / 5078 |
HGNCID: | 8618 |
Length: | 351 |
Species: | Homo sapiens |
Alignment Length: | 75 |
Identity: | 28/75 - (37%) |
Similarity: | 39/75 - (52%) |
Gaps: | 4/75 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 357 NGSYQP-GMEP---KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNR 417
:||..| |..| .|.||.::..|...|||||...:|.....|.::|....|.|..:::||.||
Human 157 SGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNR 221
Fly 418 RMKWKKDNKL 427
|.||::..||
Human 222 RAKWRRQEKL 231
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Dfd | NP_477201.1 |
Homeobox |
370..422 |
CDD:278475 |
19/51 (37%) |
PAX4 | NP_001353039.1 |
PAX |
5..129 |
CDD:128645 |
|
Homeobox |
174..226 |
CDD:306543 |
19/51 (37%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.