DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and DUXA

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001012747.1 Gene:DUXA / 503835 HGNCID:32179 Length:204 Species:Homo sapiens


Alignment Length:112 Identity:32/112 - (28%)
Similarity:52/112 - (46%) Gaps:26/112 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 ANGSYQPGM-----EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQ 415
            :.|..|||:     |.:|.||.|:..|:..|.|.|..|.|.....|.|:|..:.:.|.:::||||
Human    86 SQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAFMKNPYPGIDSREELAKEIGVPESRVQIWFQ 150

  Fly   416 NRR--------------MKWKKDNKLP-------NTKNVRKKTVDAN 441
            |||              ::.::..|:|       :|:|....|.|::
Human   151 NRRSRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSH 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/65 (31%)
DUXANP_001012747.1 homeodomain 16..74 CDD:238039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..101 4/14 (29%)
Homeobox 105..155 CDD:278475 20/49 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..204 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.