DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Nobox

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001178942.1 Gene:Nobox / 502759 RGDID:1563929 Length:524 Species:Rattus norvegicus


Alignment Length:409 Identity:97/409 - (23%)
Similarity:140/409 - (34%) Gaps:121/409 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 GHSPHSQMMDLPLQCSSTE-PPTNTALGLQELGLKLEKRIEEAVP-AGQQLQELGMRLRCDDMGS 294
            |..|.:...|       || ||.:.|..:|....||     .::| ||     ||.|    .:..
  Rat    17 GDKPRTAAQD-------TEGPPQDPAPLVQGDPDKL-----SSLPRAG-----LGKR----PLSK 60

  Fly   295 ENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGS 359
            .:.|..:.|...:..:|.....:......|.|..::  .|||      :.|.|.    ||     
  Rat    61 TSGDCIDADTCRVHTAPSPAVCSPKPQKKGSSLQEK--KAET------VKPSMS----AG----- 108

  Fly   360 YQPGMEP----------------------KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHT 402
              ||..|                      |:.||.|...|:.|||:.|..:.|....:|.|||..
  Rat   109 --PGQVPNPLNFRERDLKKEPLEATCQFRKKTRTLYRSDQLEELERIFQEDHYPDSDKRHEIAQM 171

  Fly   403 LVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQ 467
            :.::.::|.:||||||.||:|..|| |.|.      |.|| |.|      .||.|.:.:.|.:..
  Rat   172 VGVTPQRIMVWFQNRRAKWRKVEKL-NEKE------DNNG-PAP------PRANSSQCRSAPELL 222

  Fly   468 QSQQQQTQQTPVMNECI---------------------RSDSLESIGDVSSSLGNPPY------I 505
            .......:..||..|.|                     .::|.|.:......|..||.      :
  Rat   223 GPMPTDLEPGPVPPENILDGFTEPPVLLTSDQTLTSSQHNESAERVAVTPPLLSPPPIRRTNLPL 287

  Fly   506 PAAP-------ETTSSYPGSQQHLSNNNNNGSGNNNNNNNNNNSNL-----NNNNNNNQMGHTNL 558
            |..|       ......|||.. :..:...||...:..:....|||     .:...:||:|...|
  Rat   288 PLGPFQAPQVLPPLRDVPGSDS-IYKDKPCGSWGTSITSPPIYSNLEDMGPQDYQASNQLGSFQL 351

  Fly   559 HGHLQQQQSDLMTNLQLHI 577
               .|..|:.|...||..:
  Rat   352 ---TQAPQTPLFPPLQSQV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 21/51 (41%)
NoboxNP_001178942.1 COG5576 82..>192 CDD:227863 35/128 (27%)
Homeobox 138..191 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.