DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Dlx6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_008760963.2 Gene:Dlx6 / 500023 RGDID:1561539 Length:298 Species:Rattus norvegicus


Alignment Length:413 Identity:85/413 - (20%)
Similarity:120/413 - (29%) Gaps:192/413 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 PHHHSNS-AISGHHQASAGGYSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSD 171
            ||....| |::|.|......:|:..|.|...||.|.|.|           ||          |..
  Rat    60 PHSQQTSPAMAGAHYPLHCLHSAAAAAAAAGSHHHHHQH-----------HH----------HGS 103

  Fly   172 PTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPH 236
            |            .::|||...:...|       :|..|                .:||| |||:
  Rat   104 P------------YASGGGNSYNHRSL-------AAYPY----------------MSHSQ-HSPY 132

  Fly   237 SQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSE 301
            .|                                                      ...|...:.
  Rat   133 LQ------------------------------------------------------SYHNSSAAA 143

  Fly   302 EDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEP 366
            :.|                   || |:|:.......:|| |.:            ||.   |.:.
  Rat   144 QTR-------------------GD-DTDQQKTTVIENGE-IRF------------NGK---GKKI 172

  Fly   367 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTK 431
            ::.||.|:..|:..|...|...:||....|.|:|.:|.|::.|:||||||:|.|:          
  Rat   173 RKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKF---------- 227

  Fly   432 NVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVS 496
               ||.:....||......|...|.|.                          ||.:|..:.|||
  Rat   228 ---KKLLKQGSNPHESDPLPGSAALSP--------------------------RSPALPPVWDVS 263

  Fly   497 SS---LGNPP--YIPAAPETTSS 514
            :|   :..||  |:|......||
  Rat   264 ASAKGVSMPPNSYMPGYSHWYSS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
Dlx6XP_008760963.2 COG5576 124..280 CDD:227863 59/285 (21%)
Homeobox 175..229 CDD:395001 22/66 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.