DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Tlx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001102636.1 Gene:Tlx1 / 499361 RGDID:1563655 Length:333 Species:Rattus norvegicus


Alignment Length:442 Identity:98/442 - (22%)
Similarity:139/442 - (31%) Gaps:185/442 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNG--YGPAANVPN------------TSNGGG 190
            ||   |.||.       |..|.......:.:.|..|  .|||:.:.:            .:.|||
  Rat     6 PH---HLHPG-------HAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGG 60

  Fly   191 GGGSGAVLGG---------GAVGGSANG---------YYGGY-------------GGGYGTANGS 224
            |..:||..||         |..||.|.|         ..|.|             |||.|...|.
  Rat    61 GSAAGAGAGGTGAYGTGGPGGPGGPAGGGGGACSMGPLAGSYNVNMALAGGPGPGGGGGGAGAGG 125

  Fly   225 VGSTHSQG------HSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQEL 283
            .|:..:.|      |.|.:..:..| |..:|..||..::              .|||....|..|
  Rat   126 AGALSAAGVIRVPAHRPLAGAVAHP-QPLATGLPTVPSV--------------PAVPGVNNLTGL 175

  Fly   284 GMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMK 348
                                                                       .:|||:
  Rat   176 -----------------------------------------------------------TFPWME 181

  Fly   349 ------KIHVAGVANGSYQPGMEPKRQ--RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVL 405
                  |....|   ..||....||::  ||::||.||.||||.||..:||....|..:|..|.:
  Rat   182 SNRRYTKDRFTG---HPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKM 243

  Fly   406 SERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQ------ 464
            ::.|:|.||||||.||::.                           |......::|||.      
  Rat   244 TDAQVKTWFQNRRTKWRRQ---------------------------TAEEREAERQQANRILLQL 281

  Fly   465 QQQQSQQQQTQQTPVMNECIRSDSLESI------GDVSSSLGNPPYIPAAPE 510
            ||:..|:...|..|....|:.:.||.::      .|.|:.:.:...:.:|.|
  Rat   282 QQEAFQKSLAQPLPADPLCVHNSSLFALQNLQPWSDDSTKITSVTSVASACE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 26/51 (51%)
Tlx1NP_001102636.1 Homeobox 207..260 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.