DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001094257.1 Gene:Hoxb4 / 497988 RGDID:1560113 Length:250 Species:Rattus norvegicus


Alignment Length:449 Identity:124/449 - (27%)
Similarity:151/449 - (33%) Gaps:217/449 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFLMGYPHAPHHVQSPMSMGNGLDPKFPPLADDYHHYNGHYSMTASTGHMSGAVGGGAGVGSV 65
            |||||:.              .|.:||||||..:        ||.                    
  Rat     3 MSSFLIN--------------SNYVDPKFPPCEE--------YSQ-------------------- 25

  Fly    66 GGGGAGGMTGHPHSMHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSS- 129
                                 |||:...|:|..::......          ||....:|.|..: 
  Rat    26 ---------------------SDYLPSDHSPGYYAGGQRRE----------SGFQPEAAFGRRAP 59

  Fly   130 ----NYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGG 190
                .||....|..|...|...|                      .|..|..|.|.|.:|     
  Rat    60 CTVQRYAACRDPGPPPPPPPPPP----------------------PPPPGLSPRAPVQST----- 97

  Fly   191 GGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNT 255
               :||:|                                ......|:::      ||:.||.  
  Rat    98 ---AGALL--------------------------------PEPGQRSEVV------SSSPPPP-- 119

  Fly   256 ALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDND 320
                               |..|.                          .|..||         
  Rat   120 -------------------PCAQN--------------------------PLHPSP--------- 130

  Fly   321 DDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEF 385
                         :.:...|.::||||:|:||:.| |.:|..| ||||.||||||.|:|||||||
  Rat   131 -------------SHSACKEPVVYPWMRKVHVSTV-NPNYAGG-EPKRSRTAYTRQQVLELEKEF 180

  Fly   386 HYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNP 444
            |||||||||||:||||.|.||||||||||||||||||||:||||||.....|..|.|.|
  Rat   181 HYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGTAGAAGGP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 46/51 (90%)
Hoxb4NP_001094257.1 Homeobox 164..218 CDD:395001 47/53 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6061
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm44629
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.