DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb6

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_006247294.1 Gene:Hoxb6 / 497986 RGDID:1562142 Length:224 Species:Rattus norvegicus


Alignment Length:306 Identity:95/306 - (31%)
Similarity:118/306 - (38%) Gaps:106/306 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SSNYANATPP----SHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNG 188
            ||.:.|:|.|    |...|.....|..|.||               :||...| ||...|..   
  Rat     2 SSYFVNSTFPVTLASGQESFLGQLPLYSSGY---------------ADPLRHY-PAPYGPGP--- 47

  Fly   189 GGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPT 253
                       |...|.:|:.||...|||||                                  
  Rat    48 -----------GQDKGFAASSYYPPAGGGYG---------------------------------- 67

  Fly   254 NTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSND 318
                              .|.|.              |.|.......|:|........||.....
  Rat    68 ------------------RAAPC--------------DYGPAPAFYREKDAACALSGADEPPPFH 100

  Fly   319 NDDDLGDSDSDEDLMAETTDGE--RIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILEL 381
            .:....|...|:.:..||.:.:  ..:||||::::...  :.|:.|  ..:|.|..|||:|.|||
  Rat   101 PEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCN--SSSFGP--SGRRGRQTYTRYQTLEL 161

  Fly   382 EKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL 427
            ||||||||||||||||||||.|.|:|||||||||||||||||::||
  Rat   162 EKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 44/51 (86%)
Hoxb6XP_006247294.1 Homeobox 150..203 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.