DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hoxb7

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001017480.1 Gene:Hoxb7 / 497985 RGDID:1559918 Length:219 Species:Rattus norvegicus


Alignment Length:318 Identity:106/318 - (33%)
Similarity:124/318 - (38%) Gaps:120/318 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 YANATPPSHPHSH----PHAHPHQSLGYYVHHAPEFISAGAVHSDPTN-GYGPAANVPNTSNGGG 190
            ||||....:|.:.    |.|.|.|             ::.|..|:|.. |||.....|.:::..|
  Rat     6 YANALFSKYPAASSVFAPGAFPEQ-------------TSCAFASNPQRPGYGAGPGAPFSASVQG 57

  Fly   191 --GGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPT 253
              .|      |||..|.||.|.   |..|||....|..                 :.|:..|   
  Rat    58 LYSG------GGGMAGQSAAGV---YEAGYGLEPSSFN-----------------MHCAPFE--- 93

  Fly   254 NTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSND 318
                  |.|         ..|..|...:..|               ::|.|              
  Rat    94 ------QNL---------SGVCPGDPAKAAG---------------AKEQR-------------- 114

  Fly   319 NDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEK 383
                      |.||.||:...   |||||:            ..|.|.||.|..|||:|.|||||
  Rat   115 ----------DSDLAAESNFR---IYPWMR------------SSGTERKRGRQTYTRYQTLELEK 154

  Fly   384 EFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL--PNTKNVRKKTVD 439
            ||||||||||||||||||.|.|:|||||||||||||||||:||.  |.|....|...|
  Rat   155 EFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEAD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 44/51 (86%)
Hoxb7NP_001017480.1 Antp-type hexapeptide 126..131 4/4 (100%)
Homeobox 141..193 CDD:278475 44/51 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..219 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.