DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Tlx3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_573065.4 Gene:Tlx3 / 497881 RGDID:1564190 Length:291 Species:Rattus norvegicus


Alignment Length:383 Identity:88/383 - (22%)
Similarity:136/383 - (35%) Gaps:115/383 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSN--GGGGGGSGAVLGGGA 202
            |.|....|||:.:.:.:..         :.:.|.....||...|:.::  ||..||.     .||
  Rat     4 PASAQTPHPHEPISFGIDQ---------ILNSPDQDSAPAPRGPDGASYLGGPPGGR-----PGA 54

  Fly   203 VGGSANGYYGGYGGGYGTANGS---------VGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALG 258
            ...|....:.|.|..:..| ||         .|......|.|      ||   .:..||..:|| 
  Rat    55 AYPSLPASFAGLGAPFEDA-GSYSVNLSLAPAGVIRVPAHRP------LP---GAVPPPLPSAL- 108

  Fly   259 LQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDL 323
                         .|:|:...:..||        |.....|....|.:.||.             
  Rat   109 -------------PAMPSVPTVSSLG--------GLNFPWMESSRRFVKDRF------------- 139

  Fly   324 GDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQ--RTAYTRHQILELEKEFH 386
                :....:...|...||.:|              ||....|||:  ||:::|.||.||||.||
  Rat   140 ----TAAAALTPFTVTRRIGHP--------------YQNRTPPKRKKPRTSFSRVQICELEKRFH 186

  Fly   387 YNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKP 451
            ..:||....|..:|.:|.:::.|:|.||||||.||::.                    |...::.
  Rat   187 RQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQ--------------------TAEEREA 231

  Fly   452 TKRAASKKQQQAQQQ--QQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPA 507
            .::.||:...|.|..  |:|.....|..|:   |:.:.||.::.::.....:...:||
  Rat   232 ERQQASRLMLQLQHDAFQKSLNDSIQPDPL---CLHNSSLFALQNLQPWEEDSSKVPA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
Tlx3XP_573065.4 Homeobox 169..223 CDD:395001 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.