DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxa1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001008017.1 Gene:hoxa1 / 493379 XenbaseID:XB-GENE-480737 Length:323 Species:Xenopus tropicalis


Alignment Length:485 Identity:116/485 - (23%)
Similarity:152/485 - (31%) Gaps:213/485 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFLMGYPHAPHHVQSPMS--MGNGLDPKFPPLADDYHHYNGHYSMTASTGHMSG----AVGGG 59
            ||||| .||       ..||  :|......|.|    .|......|...|..:.:.    .||.|
 Frog     6 MSSFL-EYP-------GLMSGDLGTCSSRSFHP----DHGITTFQSCAVSANNCNSDDRFVVGRG 58

  Fly    60 AGVGSVGGGGAGGMTGHPHSMHPADMVSDYMA---HHHNPHSHSHSHT--------HSLPHHHSN 113
            ..:.|           |||..|       :.|   .|||....|::||        .:....:|:
 Frog    59 VQISS-----------HPHHHH-------HQAGAFQHHNNLGMSYTHTSCGSNYGMQNFSPGYSH 105

  Fly   114 SAISGHHQASAG----GYSSNYANATPPSHPH-SHPHAHPHQSLGYYVHHAPEFISAGAVHSDPT 173
            ..|:.....|||    .||.|.|::....|.| |:.....|     |:||:              
 Frog   106 FPINQEADVSAGFPQSVYSGNIASSVVQHHQHQSYIEGSAH-----YIHHS-------------- 151

  Fly   174 NGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQ 238
              |||..|:                       |...|           |.:|.|.|         
 Frog   152 --YGPDQNI-----------------------SVANY-----------NNNVSSLH--------- 171

  Fly   239 MMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEED 303
                                                        :..|..|              
 Frog   172 --------------------------------------------ISQREVC-------------- 178

  Fly   304 RLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMK---KIHVAGVANGSYQPGME 365
                 |||.                     :||:.|....:.|||   .....|.| |.|....:
 Frog   179 -----RSPS---------------------SETSPGPAQTFDWMKVKRNPPKTGKA-GEYGFAGQ 216

  Fly   366 PKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK---L 427
            |...||.:|..|:.|||||||:|:||||.||:|||..|.|:|.|:||||||||||.||..|   |
 Frog   217 PNTARTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKKREKEGLL 281

  Fly   428 PNTKNV------RKKTVDANGNPTPVAKKP 451
            |.:.:.      :.:.:....|.:|.|..|
 Frog   282 PISPSASTGSDEKSEELSEKSNSSPCAPSP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
hoxa1NP_001008017.1 Homeobox 221..274 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.