DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hbn

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:368 Identity:75/368 - (20%)
Similarity:109/368 - (29%) Gaps:175/368 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 MVSDYMAHHHNPHSHSHSHTHSLPHHHS-----------NSAISGHHQASAGGYSSNYANATPP- 137
            |::...:.||..|..........|...|           :..:...||..        .:.||. 
  Fly     1 MMTTTTSQHHQHHPIMPPAMRPAPVQESPVSRPRAVYSIDQILGNQHQIK--------RSDTPSE 57

  Fly   138 ---SHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLG 199
               :|||   |.|||     ::||         :||..:||                        
  Fly    58 VLITHPH---HGHPH-----HIHH---------LHSSNSNG------------------------ 81

  Fly   200 GGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSP---HS----QMMDLPLQCSSTEPPTNTAL 257
                                  :..:.....|.||.   ||    |...|.:|....:.||||..
  Fly    82 ----------------------SNHLSHQQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTNTDG 124

  Fly   258 GLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDD 322
            ||..                                                        ||||:
  Fly   125 GLDV--------------------------------------------------------DNDDE 133

  Fly   323 LGDS-DSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFH 386
            |..| ::..||    :|.||     .:|:                :|.||.:|..|:.:||:.|.
  Fly   134 LSSSLNNGHDL----SDMER-----PRKV----------------RRSRTTFTTFQLHQLERAFE 173

  Fly   387 YNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPN 429
            ..:|.....|.::|..|.|||.::::||||||.||:|..|..|
  Fly   174 KTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 21/51 (41%)
hbnNP_788420.1 Homeobox 156..209 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.