DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxc8a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001005771.1 Gene:hoxc8a / 449648 ZFINID:ZDB-GENE-990415-114 Length:250 Species:Danio rerio


Alignment Length:161 Identity:59/161 - (36%)
Similarity:86/161 - (53%) Gaps:21/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 LDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRT 371
            |.:.||...||..:...|.....::      ....:::|||:. |..|..||           |.
Zfish   108 LAQYPDCKSSNSTNPGEGQGHLSQN------SSPSLMFPWMRP-HAPGRRNG-----------RQ 154

  Fly   372 AYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDN---KLPNTKNV 433
            .|:|:|.|||||||.:|.||||:||||::|.|.|:|||:|||||||||||||:|   |.|..:..
Zfish   155 TYSRYQTLELEKEFLFNPYLTRKRRIEVSHALSLTERQVKIWFQNRRMKWKKENNKDKFPGQRGE 219

  Fly   434 RKKTVDANGNPTPVAKKPTKRAASKKQQQAQ 464
            .:...:..||....|::...:...:|::..:
Zfish   220 AEAEAEEEGNEDGEAEEGEDKETEEKEESKE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
hoxc8aNP_001005771.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..152 10/46 (22%)
Antp-type hexapeptide. /evidence=ECO:0000255 138..143 2/4 (50%)
Homeobox 153..205 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..250 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.