DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and MSX1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_002439.2 Gene:MSX1 / 4487 HGNCID:7391 Length:303 Species:Homo sapiens


Alignment Length:305 Identity:72/305 - (23%)
Similarity:103/305 - (33%) Gaps:111/305 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GGGYGTANGSVGST------HSQGHSPHSQMMDLP-----LQCSSTEPPTNTALGLQELGLKLEK 268
            |||.|.|..:..:|      ..:|..|......||     |.....:|      |.:|..|...:
Human    26 GGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKP------GAKESALAPSE 84

  Fly   269 RIEEAVPAGQQLQELGM---RLRCDDMGSENDDMSE----------EDRLMLDRSPDELGSNDND 320
            .::   .||...|.||:   .|...|..|....:..          ||.|:...||::       
Human    85 GVQ---AAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEK------- 139

  Fly   321 DDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEP------------------- 366
                         .|.|       |||:            .|...|                   
Human   140 -------------PERT-------PWMQ------------SPRFSPPPARRLSPPACTLRKHKTN 172

  Fly   367 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK--DNKLPN 429
            ::.||.:|..|:|.||::|...:||:...|.|.:.:|.|:|.|:||||||||.|.|:  :.:|..
Human   173 RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEK 237

  Fly   430 TKNVRKKTVDAN--------GNPTPV----------AKKPTKRAA 456
            .|...|..:...        |.|..|          |..|.:|||
Human   238 LKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
MSX1NP_002439.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..117 12/56 (21%)
PTZ00449 <105..>248 CDD:185628 43/181 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..174 9/79 (11%)
Homeobox 175..229 CDD:395001 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.