DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and pax3

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_012825755.1 Gene:pax3 / 448464 XenbaseID:XB-GENE-482740 Length:486 Species:Xenopus tropicalis


Alignment Length:349 Identity:79/349 - (22%)
Similarity:128/349 - (36%) Gaps:83/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 CSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRS 310
            |.....|:.:::. :.|..|..|..||.:...::.||          .||.......|.::.:|:
 Frog   144 CDRNTVPSVSSIS-RILRSKFGKGDEEDIELDRKEQE----------ESEKRAKHSIDGILRERA 197

  Fly   311 PDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTR 375
            |    ::...::..|.||:.||            |..:|                .:|.||.:|.
 Frog   198 P----ASPESEEGSDIDSEPDL------------PLKRK----------------QRRSRTTFTA 230

  Fly   376 HQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKD---NKLPNTKNVRKKT 437
            .|:.|||:.|....|.....|.|:|....|:|.::::||.|||.:|:|.   |:|.         
 Frog   231 EQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGANQLM--------- 286

  Fly   438 VDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGNP 502
              |..:..|.|..|....|....|.::...|........:...|...|...|.......|||   
 Frog   287 --AFNHLIPGAFPPAAMPALPTYQLSETSYQPTSIPQAVSDPSNTVHRPQPLPPSSVHQSSL--- 346

  Fly   503 PYIPAAPETTSSY--PGSQQHLSNNNNN---GSGNNNNNNNNNNSNLNNNNNNNQMGHTNLHGHL 562
               |:.||::|:|  |..:...|:..::   .||    .:|..|..:.|..:...||....||.:
 Frog   347 ---PSNPESSSAYCLPSGRHGFSSYTDSFVPPSG----PSNPMNPAIGNGLSPQVMGLLTNHGGV 404

  Fly   563 QQQQSDLMTNLQLHIKQDYDLTAL 586
            ..|.           :.||.|:.|
 Frog   405 PHQP-----------QTDYALSPL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 19/51 (37%)
pax3XP_012825755.1 PAX 35..162 CDD:238076 3/18 (17%)
Homeobox 224..278 CDD:365835 20/53 (38%)
Pax7 349..393 CDD:372070 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.