DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and zgc:101100

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001003563.1 Gene:zgc:101100 / 445169 ZFINID:ZDB-GENE-040801-82 Length:266 Species:Danio rerio


Alignment Length:208 Identity:44/208 - (21%)
Similarity:81/208 - (38%) Gaps:60/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 VANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRM 419
            :....|....:.:|.|||::..|:..|||.|...:|.....|..:|..:.|.|.:|::||:|||.
Zfish    60 ILEARYGNQQKQRRSRTAFSVSQLQALEKAFQQTQYPDVGMRERLAVCINLPEARIQVWFKNRRA 124

  Fly   420 KWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNE-- 482
            |::|..:..               |.|..:....|:|:|::::..:.|:.......|:.:...  
Zfish   125 KFRKGQRFA---------------PLPKEESQVHRSATKQRKELVKDQEKTYNSKPQSSIRENNP 174

  Fly   483 -CIRSDSLE---------------------------SIGDVSSSLG-NPPYIPAAPETTSSYPGS 518
             .:.:||::                           ::|.:|:.|. :|.|:|..         .
Zfish   175 ISLSADSVQLHSHPRLHSSAVLPFITAEHFQQPMPHALGLLSAGLPFSPTYVPII---------H 230

  Fly   519 QQHLSNNNNNGSG 531
            |||     |.|.|
Zfish   231 QQH-----NTGIG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 20/51 (39%)
zgc:101100NP_001003563.1 Homeobox 74..127 CDD:278475 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.