DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and nkx6.1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001002475.1 Gene:nkx6.1 / 436748 ZFINID:ZDB-GENE-040718-178 Length:312 Species:Danio rerio


Alignment Length:366 Identity:73/366 - (19%)
Similarity:116/366 - (31%) Gaps:135/366 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GGYSSNYANATPP-SHPHS--------HPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAA 180
            |...|.:...||| :..||        :| |:|..|.|                  |.:...|.|
Zfish     9 GSRQSAFLLNTPPLAALHSMTEMKTPLYP-AYPLSSTG------------------PASSTSPTA 54

  Fly   181 NVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQ 245
            ..||.  ||....|..:.....:...|:.........:|.  ..:.|..|...||...:..|| :
Zfish    55 TSPNP--GGIPVSSPGIKTSSGLSALASAQQCAIATPHGI--NDILSRPSVACSPAGILSGLP-R 114

  Fly   246 CSSTEPPTNTALGLQELG-----LKLEKRIEEAVPAGQQLQELGM---------RLRCDDMGSEN 296
            .||..||....|......     .:..|.:.| :|....:...|:         |..|.      
Zfish   115 FSSLSPPPPPGLYFSPSAAAVAVARYPKPLTE-LPGRTPIFWPGVMQSPHWRDARFACS------ 172

  Fly   297 DDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQ 361
               ..::.::||:                            ||:|                    
Zfish   173 ---PHQNSVLLDK----------------------------DGKR-------------------- 186

  Fly   362 PGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK 426
                 |..|..::..||..|||.|...:||....|..:|::|.::|.|:|:||||||.||:|   
Zfish   187 -----KHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK--- 243

  Fly   427 LPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQ 467
                                  :...:.|::||:|.::.::
Zfish   244 ----------------------RHAAEMASAKKKQDSETER 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 22/51 (43%)
nkx6.1NP_001002475.1 Homeobox 189..242 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.