DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and zfh1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_733401.3 Gene:zfh1 / 43650 FlyBaseID:FBgn0004606 Length:1206 Species:Drosophila melanogaster


Alignment Length:500 Identity:85/500 - (17%)
Similarity:144/500 - (28%) Gaps:190/500 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 AHHHNPHSHSHSH----------THSLPHHHSNSAISGHHQASA--GGYSSNYANATPPSHPHS- 142
            |...:|..|....          .|.:.:..|::.:.|...|.|  ..:..||.||...:.||: 
  Fly   434 ASRRSPSDHGKGKLPEQPSLPGLPHPMSYFASDAQVQGGSAAPAPFPPFHPNYMNAALLAFPHNF 498

  Fly   143 -------HPHAHPHQSLGYYVHHAPEFISAGA------------------------------VHS 170
                   .|..||     |.:....:..:||.                              :..
  Fly   499 MAAAAGLDPRVHP-----YSIQRLLQLSAAGQQQREEEREEQQKQQQHDEEETPDEPKLVMDIEE 558

  Fly   171 DPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSP 235
            ..|....|.......:.                                    .:....|:..||
  Fly   559 PETKEMAPTPEATEAAT------------------------------------PIKREESREASP 587

  Fly   236 HSQMMDLPLQCSSTE-PPTNTALGLQELGLKLEKR---IEEAVPAGQQLQELGMRLRCDDMGSEN 296
            ..:......|....| .|.|.|          |:|   :||..|.     |....|||.....:.
  Fly   588 DPESYRSSSQAIKQEQEPLNVA----------EERQTPVEEHAPV-----EHAADLRCSRCSKQF 637

  Fly   297 D---DMSEEDRLMLDRSPDEL---------------GSNDNDDDLGDSDSDEDLMAETTDGERII 343
            :   ::.:.::::.....:||               .:::.|::..:.|.:|:...|:  |||.:
  Fly   638 NHPTELVQHEKVLCGLIKEELEQHFQQQQATSFALASASEEDEEDEEMDVEEEPRQES--GERKV 700

  Fly   344 YPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSER 408
                                    |.|||....|..:|::.:..|...:|.....||..|.|..|
  Fly   701 ------------------------RVRTAINEEQQQQLKQHYSLNARPSRDEFRMIAARLQLDPR 741

  Fly   409 QIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANG--NPTPVAKKPTKRAASKKQQQAQQQQQSQQ 471
            .:::||||.|.:.:|.....|.:        |.|  .|.|:                    .||.
  Fly   742 VVQVWFQNNRSRERKMQSFQNNQ--------AAGAAPPMPI--------------------DSQA 778

  Fly   472 QQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYP 516
            ..|::...::..::.|.|     ...|..:|||| |.|...:..|
  Fly   779 SLTREDQPLDLSVKRDPL-----TPKSESSPPYI-APPSGEALNP 817

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 17/51 (33%)
zfh1NP_733401.3 C2H2 Zn finger 291..311 CDD:275368
C2H2 Zn finger 326..346 CDD:275368
zf-C2H2 355..377 CDD:278523
C2H2 Zn finger 357..377 CDD:275368
zf-H2C2_2 369..391 CDD:290200
Homeobox 703..755 CDD:278475 17/51 (33%)
C2H2 Zn finger 969..989 CDD:275368
zf-H2C2_2 981..1006 CDD:290200
COG5048 992..>1045 CDD:227381
C2H2 Zn finger 997..1017 CDD:275368
zf-H2C2_2 1009..1034 CDD:290200
C2H2 Zn finger 1025..1042 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.