DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and C15

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster


Alignment Length:346 Identity:75/346 - (21%)
Similarity:115/346 - (33%) Gaps:134/346 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SHPH-SHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGG 201
            ||.. .|.|.:.|          .|.:....:|.|          |.:.|....|.||...:.| 
  Fly     3 SHEEDDHEHENEH----------GEEVEEQEIHVD----------VDSDSRMSCGSGSDVDMDG- 46

  Fly   202 AVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQ-MMDLPLQCSSTEPPTNTALGLQELGLK 265
                                    ||.:.:..:|.|: :.....:.||:|   |....:..|   
  Fly    47 ------------------------GSCYDESETPLSESLQSEQTRSSSSE---NLPFSISRL--- 81

  Fly   266 LEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGD----- 325
            |.|..|                       .:......:..:|..||....:|:|..:.|:     
  Fly    82 LSKPFE-----------------------TSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKELL 123

  Fly   326 SDSDEDL-------MAETTDGERI-------IYP------------------W-MKKIHVAGVAN 357
            ...|.||       :|.:|.|...       :||                  | :..:|.|.:|:
  Fly   124 QQEDHDLAYKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRTPLTWALPPLHHAALAH 188

  Fly   358 GS------------------YQPGMEPKRQ--RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHT 402
            .:                  ||....|||:  ||::||.|:.||||.||..:||....|..:|..
  Fly   189 QAVKDRLAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARG 253

  Fly   403 LVLSERQIKIWFQNRRMKWKK 423
            |.:::.|:|.||||||.||::
  Fly   254 LKMTDAQVKTWFQNRRTKWRR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
C15NP_476873.2 COG5576 <196..315 CDD:227863 31/79 (39%)
Homeobox 220..273 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.