DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and lbl

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster


Alignment Length:248 Identity:68/248 - (27%)
Similarity:101/248 - (40%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 QELGLKLEKRIEEAVPAGQQL------------QELGMRLRCDDMGSEN--------------DD 298
            |.|....:::::|...|..||            .|.|...|.....|.|              :.
  Fly   125 QRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEK 189

  Fly   299 MSEEDRLML-DRSPDE--LGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSY 360
            .|:|||:.: .:||:|  .|::.:.   ||:..|......|.:.:....|....|         :
  Fly   190 RSQEDRMEVPKKSPEEQPKGASKSS---GDTPLDALFQLSTKNFDEEQDPATLNI---------F 242

  Fly   361 QPGMEPKRQ---RTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWK 422
            .....||::   |||:|..||.||||.|.|.:||:...|.|||..|.||..|:..||||||.|.|
  Fly   243 ATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLK 307

  Fly   423 KDNKLPNTKNVR-KKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQT 474
            :|.: ...|:|: :|..|.:.:|        .|:........||.|.....|:
  Fly   308 RDME-ELKKDVQCEKIPDQSADP--------NRSHHNHPHYHQQHQHYAHMQS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 29/51 (57%)
lblNP_001262805.1 COG5576 206..332 CDD:227863 45/146 (31%)
Homeobox 254..307 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.