DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and MEOX2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_005915.2 Gene:MEOX2 / 4223 HGNCID:7014 Length:304 Species:Homo sapiens


Alignment Length:437 Identity:99/437 - (22%)
Similarity:142/437 - (32%) Gaps:202/437 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VQSPMSMGNGLDPKFPPLADDYHHYNGHYSMTASTGHMSGAVGGGAGVGSVGGGGAGGMTGHPHS 79
            ::||.:...||.| |...:...|..:.|.|....:...|..:                :.|:|:.
Human     9 LRSPHATAQGLHP-FSQSSLALHGRSDHMSYPELSTSSSSCI----------------IAGYPNE 56

  Fly    80 MHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANATPPSHPHSHP 144
                  ...:.:.||..|.|.|.|.|   |||       |.|.......:|:             
Human    57 ------EGMFASQHHRGHHHHHHHHH---HHH-------HQQQQHQALQTNW------------- 92

  Fly   145 HAHPHQSLGYYVHHAPEFIS--AGAVHS---DPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVG 204
                         |.|:..|  :.|.||   .|.:| ||.                         
Human    93 -------------HLPQMSSPPSAARHSLCLQPDSG-GPP------------------------- 118

  Fly   205 GSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKR 269
                                     ..|.||       |:.||:     :::||           
Human   119 -------------------------ELGSSP-------PVLCSN-----SSSLG----------- 135

  Fly   270 IEEAVPAGQQLQELGMRLRC--DDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDL 332
              .:.|.|         ..|  .|.|.:....:|.::    ||    |.....|   .|||.|  
Human   136 --SSTPTG---------AACAPGDYGRQALSPAEAEK----RS----GGKRKSD---SSDSQE-- 176

  Fly   333 MAETTDGERIIYPWMKKIHVAGVANGSY--QPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRR 395
                                     |:|  :...:|:::|||:|:.||.|||.||.::.||||.|
Human   177 -------------------------GNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLR 216

  Fly   396 RIEIAHTLVLSERQIKIWFQNRRMKWK-----------KDNKLPNTK 431
            |.|||..|.|:|||:|:||||||||||           ::.:|.|.|
Human   217 RYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
MEOX2NP_005915.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..192 48/287 (17%)
COG5576 160..284 CDD:227863 50/142 (35%)
Homeobox 191..243 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.