DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and MEOX1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:342 Identity:82/342 - (23%)
Similarity:113/342 - (33%) Gaps:150/342 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NPHSHSHSHTHSLPHH-------HSNSAISGHHQASAGGYSSNYANATP---PSHPHSHPHAHPH 149
            ||||..:. ...|||:       |..........|:...:|::...|||   |...|.....|| 
Human    24 NPHSEGNG-ASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHP- 86

  Fly   150 QSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYY--- 211
                             |....| |.:.|.::.....|.|..|||      ..:|.|:.|..   
Human    87 -----------------AFPQSP-NWHFPVSDARRRPNSGPAGGS------KEMGTSSLGLVDTT 127

  Fly   212 GGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPA 276
            ||.|..||.    :|||                 .:.||.             |..:|.:|    
Human   128 GGPGDDYGV----LGST-----------------ANETEK-------------KSSRRRKE---- 154

  Fly   277 GQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGER 341
                                                   |:||.::.|..:...           
Human   155 ---------------------------------------SSDNQENRGKPEGSS----------- 169

  Fly   342 IIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLS 406
                                   :.:::|||:|:.|:.|||.||.::.||||.||.|||..|.||
Human   170 -----------------------KARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLS 211

  Fly   407 ERQIKIWFQNRRMKWKK 423
            |||:|:||||||||||:
Human   212 ERQVKVWFQNRRMKWKR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 32/227 (14%)
Homeobox 175..227 CDD:306543 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.