DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and mnx2b

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001315287.1 Gene:mnx2b / 406206 ZFINID:ZDB-GENE-040415-2 Length:328 Species:Danio rerio


Alignment Length:274 Identity:72/274 - (26%)
Similarity:119/274 - (43%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 GGYGTANGSVGSTHSQ-GHSPHSQMMDLPLQCSSTEPPTNT-------ALGLQELGLKLEKRIEE 272
            |...:..|:.|:.|.| |..|...:::||....::.|...|       |||.|...|......:.
Zfish    43 GDTPSPRGTPGAIHLQPGIIPKPGLLNLPHPGLTSIPGMYTTPMYPISALGGQHPALAYTGFTQL 107

  Fly   273 AVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPD---ELGSNDNDDDLGDSDSDEDLMA 334
            ..|..:||:...|      .||...:......:|:.|.||   |.||                  
Zfish   108 TQPYPEQLKAAAM------AGSLPLEHWIRAGIMVPRLPDYTCEWGS------------------ 148

  Fly   335 ETTDGERIIYPWMKKIHVAGVANGSYQPGMEPK--RQRTAYTRHQILELEKEFHYNRYLTRRRRI 397
                                :...:.|.|:..|  |.|||:|..|:||||.:|..|:||:|.:|.
Zfish   149 --------------------IQMTAPQSGLMGKCRRPRTAFTSQQLLELENQFKLNKYLSRPKRF 193

  Fly   398 EIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQ 462
            |:|.:|:|:|.|:||||||||||||:..|.  .:...:..|:.....|..:.:.::||.:....:
Zfish   194 EVATSLMLTETQVKIWFQNRRMKWKRSRKA--KEQAAQVEVERQRGGTKPSGRDSRRAPAAPSVE 256

  Fly   463 AQQQQQSQQQQTQQ 476
            .|::::.::::..:
Zfish   257 EQEEEEEEEEEIDE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 31/51 (61%)
mnx2bNP_001315287.1 Homeobox 165..218 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.