DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and cdx1a

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a / 405762 ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio


Alignment Length:385 Identity:88/385 - (22%)
Similarity:125/385 - (32%) Gaps:184/385 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GYSSNYANATPPSHPHSHPHA--------HPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANV 182
            |..:.:.|.:.| |.:.:|.|        ||..:||..:||         ..|..:.|:||    
Zfish    13 GNPARHLNLSQP-HLNVYPSAPYPDYSGYHPGPALGNDLHH---------TGSSWSPGFGP---- 63

  Fly   183 PNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCS 247
                                  ||.:.:...||             |..|||             
Zfish    64 ----------------------GSRDDWPPLYG-------------HGTGHS------------- 80

  Fly   248 STEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPD 312
                                      :||.               |.|...:...|:.:|..:| 
Zfish    81 --------------------------LPAN---------------GVEVSVLPSVDQGLLSGAP- 103

  Fly   313 ELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPK---RQRTAYT 374
                       .|.:..:|              ||::..|      ...||.:.:   :.|..|:
Zfish   104 -----------VDREEPQD--------------WMRRSAV------PTNPGGKTRTKDKYRVVYS 137

  Fly   375 RHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVD 439
            ..|.||||||||::||:|.||:.|:|.||.|||||:||||||||.|.:|.||             
Zfish   138 DVQRLELEKEFHFSRYITIRRKAELAGTLNLSERQVKIWFQNRRAKERKMNK------------- 189

  Fly   440 ANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSL 499
                                 ::.||.|||.......|.|.:    |||.....::|||:
Zfish   190 ---------------------KRLQQVQQSSSGLANTTTVSS----SDSGLMTDNISSSI 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
cdx1aNP_998001.2 Caudal_act 11..115 CDD:282574 35/230 (15%)
COG5576 <122..227 CDD:227863 52/141 (37%)
Homeobox 133..185 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.