DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and msx2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002936749.1 Gene:msx2 / 394987 XenbaseID:XB-GENE-852974 Length:256 Species:Xenopus tropicalis


Alignment Length:225 Identity:54/225 - (24%)
Similarity:81/225 - (36%) Gaps:77/225 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVP---------AGQ 278
            |.|..|.|.......::..||....:               |..:||:.:..|         ||.
 Frog    17 GQVHPTLSPSDDHKIKVSSLPFSVEA---------------LMADKRVPKEAPHLRGVDASAAGS 66

  Fly   279 QLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELG-SNDNDDDLGDSDSDEDLMAETTDGERI 342
            ..:.|.|.:|                    .||...| :...:.....|::.||....:.||   
 Frog    67 TPRHLHMGIR--------------------DSPSPPGLTKTFETSSVKSENSEDGTTWSKDG--- 108

  Fly   343 IYPWMKKIHVAGVANGSYQP---GMEP-----------KRQRTAYTRHQILELEKEFHYNRYLTR 393
                           |||.|   .:.|           ::.||.:|..|:|.||::|...:||:.
 Frog   109 ---------------GSYSPPPRHLSPSTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSI 158

  Fly   394 RRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
            ..|.|.:.:|.|:|.|:||||||||.|.|:
 Frog   159 AERAEFSSSLNLTETQVKIWFQNRRAKAKR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
msx2XP_002936749.1 Homeobox 134..188 CDD:365835 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.