DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and hoxb9

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_988879.1 Gene:hoxb9 / 394474 XenbaseID:XB-GENE-963094 Length:247 Species:Xenopus tropicalis


Alignment Length:260 Identity:79/260 - (30%)
Similarity:113/260 - (43%) Gaps:54/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 AVGGSANGYY--------------GGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQC------ 246
            |:.|:.:.|:              ..:.|.|       .|.....||.||:.:|.| .|      
 Frog     2 AISGTLSNYFVESIISPESEEAPAAKFSGQY-------PSPRPAAHSAHSEPLDFP-SCSFQPKA 58

  Fly   247 ---SSTEPPTN--TALGLQELGLKLEKRIEEAVPA--GQQLQELGMRLRCDDMGSENDDMSEEDR 304
               |::..|.|  .|..|..:   ....|::..|.  |:.|:.....|:..:.|.....:..|..
 Frog    59 PVFSASWSPLNPHPASPLPSV---YHPYIQQGAPTPEGRYLRGWLEPLQRAENGPGQGTVKSEPL 120

  Fly   305 LMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQP------- 362
            |......|:||:...  :||...:.||.      .||..:|..|....:|..:.::|.       
 Frog   121 LGPPGELDKLGAQQY--NLGSPAAREDA------NERATFPDNKLCEGSGDKDRTHQSNPSANWL 177

  Fly   363 -GMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK 426
             ....:::|..||::|.|||||||.:|.||||.||.|:|..|.|||||:||||||||||.||.||
 Frog   178 HARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKLNK 242

  Fly   427  426
             Frog   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 36/51 (71%)
hoxb9NP_988879.1 Hox9_act 1..169 CDD:368024 38/185 (21%)
Homeobox 185..239 CDD:365835 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.