DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ventx2.1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_988862.1 Gene:ventx2.1 / 394456 XenbaseID:XB-GENE-919664 Length:333 Species:Xenopus tropicalis


Alignment Length:484 Identity:100/484 - (20%)
Similarity:144/484 - (29%) Gaps:227/484 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SDYMAHHHNP----HSHSHSHTHSLPHHHSN----------SAISGHHQAS----AGGYSSN--- 130
            |...:|...|    ..:|...:.|||..:|:          |.::|..|.|    :..|||:   
 Frog    23 SSRRSHKEQPSKGDQRYSPYPSPSLPSWNSDVSPSSWNSQLSPVAGSAQVSPCPGSAQYSSDSEL 87

  Fly   131 --YAN----------ATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSD-PTNGY----GP 178
              |:|          ...||.|..:                      |.:|.| .|:.|    ..
 Frog    88 SLYSNEDEDLFCEKDLNTPSTPGDN----------------------GLLHRDTATHEYSGMVSV 130

  Fly   179 AANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLP 243
            .||.|.|::......|                      ||.|:..|       |:...:.     
 Frog   131 PANTPRTTSNEDAAKS----------------------GYSTSTDS-------GYESEAS----- 161

  Fly   244 LQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLD 308
             :.|||.|..:..:.|                                  |.||...||.:|   
 Frog   162 -RSSSTAPEGDATVSL----------------------------------SPNDTSDEEGKL--- 188

  Fly   309 RSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAY 373
                                          |.|:                           |||:
 Frog   189 ------------------------------GRRL---------------------------RTAF 196

  Fly   374 TRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKD--NKLPNTKNVRK- 435
            |..||..|||.|..:|||....|.::|..|.|||.|||.||||||||:|::  :..|::.:..: 
 Frog   197 TSDQISTLEKTFQKHRYLGASERRKLAAKLQLSEVQIKTWFQNRRMKYKREIQDGRPDSYHPAQF 261

  Fly   436 -KTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQSQQQQTQQT--PVMNECIRSDSLESIGDVSS 497
             .....:..||||.            |.|.||.........:|  ..|...:...:::|:...:|
 Frog   262 FGVYGYSQQPTPVF------------QHAVQQPYPGYSPLMETLPGTMPYAMHPPAMDSLNHFNS 314

  Fly   498 SLGNPP----YIPAAPETTSSYPGSQQHL 522
                ||    |:|            ||||
 Frog   315 ----PPFQMFYMP------------QQHL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 30/51 (59%)
ventx2.1NP_988862.1 Homeobox 193..246 CDD:365835 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.