DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Dll

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster


Alignment Length:392 Identity:80/392 - (20%)
Similarity:117/392 - (29%) Gaps:161/392 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 HAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSG-------AVLGGGAVGGSAN--GYYGG 213
            |.|:::..|...:..|    |..|:|        |.|.       |..|.|.:..:..  |..||
  Fly     8 HTPKYMDGGNTAASVT----PGINIP--------GKSAFVELQQHAAAGYGGIRSTYQHFGPQGG 60

  Fly   214 YGGGYGTANGSVG----STHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAV 274
            ...|:.:...::|    ..|...:|.:        ...|..||                      
  Fly    61 QDSGFPSPRSALGYPFPPMHQNSYSGY--------HLGSYAPP---------------------- 95

  Fly   275 PAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDG 339
                          |                   .||.:       ||...||..||      .|
  Fly    96 --------------C-------------------ASPPK-------DDFSISDKCED------SG 114

  Fly   340 ERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLV 404
            .|:              ||.   |.:.::.||.|:..|:.:|.:.|...:||....|.|:|.:|.
  Fly   115 LRV--------------NGK---GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLG 162

  Fly   405 LSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRAASKKQQQAQQQQQS 469
            |::.|:||||||||.|:||..|...............|.|.|....|.:..              
  Fly   163 LTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMH-------------- 213

  Fly   470 QQQQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPETTSSYPGSQQHLSNNNNNGSGNNN 534
                                      |..|.|..::.||.||..:.  :..| |...|||.|:|:
  Fly   214 --------------------------SGELANGRFLWAALETNGTL--ALVH-STGGNNGGGSNS 249

  Fly   535 NN 536
            .:
  Fly   250 GS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 23/51 (45%)
DllNP_001137759.1 Homeobox 127..180 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.