DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Rx

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster


Alignment Length:509 Identity:109/509 - (21%)
Similarity:162/509 - (31%) Gaps:177/509 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFLMGY-------PHAPHHVQSPMSMGNGLDPKFPPLADDYHHYNGHYSMTASTGHMSGAVGG 58
            |:|.|..:       |:.|     |...| |..|:.|. |...||                    
  Fly   205 MASMLQQHAKNGGALPYGP-----PTPPG-GQQPQVPN-ATPLHH-------------------- 242

  Fly    59 GAGVGSVGGGGAGGMTGHPHSMHPADMVSDYMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQAS 123
                    |...||..||.               .|..|.|        |.||.::.. |:|.|.
  Fly   243 --------GQQMGGQAGHA---------------THAGHGH--------PTHHGHAPF-GYHNAF 275

  Fly   124 AGGYSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNG 188
            ..|..             .|.:.||.::.|.|::...:.:.|..:.:.......|.|.:|.:|.|
  Fly   276 GFGQG-------------GHGYGHPEEAAGNYLNSMHQMVEANQLQTGANGANPPPAPLPPSSFG 327

  Fly   189 GGGGGSGAVLGGGAVGGSANGYYG-----GYG-----GGYGTANGSVGSTHSQ---GHSPHSQMM 240
            .......|:........:.:..|.     |.|     |.|...:.:.....||   .....|...
  Fly   328 SHQQHLAALAAQAQEQQNQHSKYAKSSPTGAGPPPPPGAYFMESQTAPVAPSQINYDERSMSSAS 392

  Fly   241 DL--------PLQCSSTEPPTNTALGLQELGLKLE-----------KRIEEAVPAG--------- 277
            ||        .||...|.|||.:..|  :|..|.:           |.....:|.|         
  Fly   393 DLEEDDDDAAKLQLDVTSPPTPSPRG--QLAAKRKSAGVFCDDNEPKLANGQLPGGNYGIRPRSM 455

  Fly   278 -------------------QQLQELGMR------LRCDDMGSENDDMSEED---RLMLDRSPDEL 314
                               ||.|:|..:      .|....|:.|.:.:..|   ||..|......
  Fly   456 EEVHHQQQSHHHQQQQQQQQQQQQLQQQQGFQHDFRNSGNGNPNGNSNSGDHGERLNADSDSLVN 520

  Fly   315 GSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEP-------KRQRTA 372
            ||..:.:||..::|.|       .||:|             .:||...|.:.       :|.||.
  Fly   521 GSCASSEDLNQTNSSE-------QGEKI-------------TSGSDDEGQDDNCAKKKHRRNRTT 565

  Fly   373 YTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNK 426
            :|.:|:.|||:.|..:.|.....|.|:|..:.|.|.::::||||||.||::..|
  Fly   566 FTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEK 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 21/51 (41%)
RxNP_726006.3 Homeobox 563..615 CDD:278475 21/51 (41%)
OAR 876..892 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.