DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and lms

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:348 Identity:80/348 - (22%)
Similarity:112/348 - (32%) Gaps:121/348 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 DRSPDELGSNDN----------------DDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVA 356
            |...||.|...|                ||::.|..||.||.::  ||.             |:.
  Fly    33 DSVQDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDIDLASD--DGN-------------GLG 82

  Fly   357 NGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKW 421
            :.      ..||.|||::..||..||.||...:||:..:|..:|..|.|:|.||||||||||.||
  Fly    83 DD------RKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKW 141

  Fly   422 KKDNKLPNTKNVRKKTVDAN--------------------------------GNPTPV------- 447
            |           ||.|.|..                                ..|||:       
  Fly   142 K-----------RKYTSDVETLASHYYAQLGIGGLARPMVVGDRLWLFSQTPTGPTPIQSIMLNG 195

  Fly   448 --AKKPTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSL----GNPP--- 503
              :..|...|.:......:....|........|.:.|..|:..|.....::.:|    ..||   
  Fly   196 SGSAAPMASATTATGSPMRPYATSGGMPPLPGPSVMESARNAILARGQPLNFALPFGVAKPPAGG 260

  Fly   504 -----YIPAAPETTSSY-------PGSQQHL-----------SNNNNNGSGNNNNNNNNNNSNLN 545
                 |||......:||       |.::.:|           .:..:||.........:.|:|..
  Fly   261 VPAASYIPRCKPYATSYVDYAASLPTNESYLQMKYATLPPEAESGASNGLAELERVFGDANANFL 325

  Fly   546 NNNNNNQMGHTNLHGH--LQQQQ 566
            ...:....|....:||  |.|.|
  Fly   326 QQRSTPVAGTATAYGHDGLNQAQ 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 27/51 (53%)
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 25/93 (27%)
Homeobox 89..142 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.