DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Gsx2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:403 Identity:95/403 - (23%)
Similarity:118/403 - (29%) Gaps:218/403 - (54%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TGHM------SGAVGGGAGV--GSVGGGGAGGMTG------HPHSMHPADMVSDYMAHHHNPHSH 99
            |.|:      :||.||..|.  .:|.|||..|.||      ...|..|.|      |......||
  Rat    66 TSHLHSSRPPAGAGGGATGTAGAAVAGGGVAGGTGALPLLKSQFSPGPGD------AQFCPRVSH 124

  Fly   100 SHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANATPPSHPHSHPHAHPHQSLGYYVHHAPEFIS 164
            :|.|.|:..|||.      |||               |..|                        
  Rat   125 AHHHHHAPQHHHH------HHQ---------------PQQP------------------------ 144

  Fly   165 AGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTH 229
                                        ||.|.....|...:|             |..::|  |
  Rat   145 ----------------------------GSAAAAAAAAAAAAA-------------AAAALG--H 166

  Fly   230 SQGHSPHSQMMDLPLQCSST-----EPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRC 289
            .|.|:|         .|::|     :|                                 .|..|
  Rat   167 PQHHAP---------VCAATTYNVSDP---------------------------------RRFHC 189

  Fly   290 DDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAG 354
            ..||.                               ||:.:                        
  Rat   190 LTMGG-------------------------------SDTSQ------------------------ 199

  Fly   355 VANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRM 419
            |.||        ||.|||:|..|:||||:||..|.||:|.||||||..|.|||:|:||||||||:
  Rat   200 VPNG--------KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRV 256

  Fly   420 KWKKDNKLPNTKN 432
            |.||:.|..:..|
  Rat   257 KHKKEGKGASRNN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4588
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.