DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Meox1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:228 Identity:76/228 - (33%)
Similarity:100/228 - (43%) Gaps:47/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GSVGSTHSQGHS----PH--------SQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVP 275
            |.:.:.||:|.|    ||        .|..|.|...:..:..|:..........:.|:...|..|
  Rat    20 GCLRNPHSEGSSASGLPHYPPTPFSFHQKSDFPATAAYPDFSTSCLAATPHSLPRAERIFNEQHP 84

  Fly   276 AGQQ-------LQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLM 333
            |..|       :.|.|.||.....||.        |.|...||   |..|....||     ||.|
  Rat    85 AFPQTPDWHFPISEAGQRLNLGPAGSA--------REMGAGSP---GLVDGTGGLG-----EDCM 133

  Fly   334 AETTDGERIIYPWMKKI------HVAGVANGSYQP--GMEPKRQRTAYTRHQILELEKEFHYNRY 390
            ...|    |.:...||:      ......||..:|  ..:.:::|||:|:.|:.|||.||.::.|
  Rat   134 VLGT----IAHETEKKLSRRKKERSDNPENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNY 194

  Fly   391 LTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 423
            |||.||.|||..|.|||||:|:||||||||||:
  Rat   195 LTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 34/51 (67%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 41/89 (46%)
Homeobox 174..227 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.