DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and en

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster


Alignment Length:410 Identity:93/410 - (22%)
Similarity:140/410 - (34%) Gaps:146/410 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANAT-PPSHPHSHPHAHPHQS-LGYY-- 155
            ||.::...|...:......||                |||. ||........|:|.:| ||..  
  Fly   253 NPAAYPRIHEEIVQSRLRRSA----------------ANAVIPPPMSSKMSDANPEKSALGSLCK 301

  Fly   156 ------------VHHAPEFISAGAVHSDPTNGYGPAAN---VPNTSN---GGGGGGSGAVLGGGA 202
                        :...|...||.::.|.|     ||:|   :.:||:   ......||......:
  Fly   302 AVSQIGQPAAPTMTQPPLSSSASSLASPP-----PASNASTISSTSSVATSSSSSSSGCSSAASS 361

  Fly   203 VGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLE 267
            :..|.:...|..|.|   .|.|         ||..|    |:      ||.:..           
  Fly   362 LNSSPSSRLGASGSG---VNAS---------SPQPQ----PI------PPPSAV----------- 393

  Fly   268 KRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDL 332
                                 ..|.|.|:.|.:.          .|.||                
  Fly   394 ---------------------SRDSGMESSDDTR----------SETGS---------------- 411

  Fly   333 MAETTDGERIIYP-WMKKIHVAGVANGS--YQPGMEP-------KRQRTAYTRHQILELEKEFHY 387
             ..|..|:..::| |:.....:...:..  |:...:|       ||.|||::..|:..|::||:.
  Fly   412 -TTTEGGKNEMWPAWVYCTRYSDRPSSGPRYRRPKQPKDKTNDEKRPRTAFSSEQLARLKREFNE 475

  Fly   388 NRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANG--NPTPVAKK 450
            |||||.|||.:::..|.|:|.||||||||:|.|.||..   .:||.....:.|.|  |.|.|   
  Fly   476 NRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKST---GSKNPLALQLMAQGLYNHTTV--- 534

  Fly   451 PTKRAASKKQQQAQQQQQSQ 470
                ..:|::::.:.:...|
  Fly   535 ----PLTKEEEELEMRMNGQ 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 28/51 (55%)
enNP_523700.2 Homeobox 457..510 CDD:278475 28/52 (54%)
Engrail_1_C_sig 512..541 CDD:287495 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.