DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Hmx1

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001101833.2 Gene:Hmx1 / 360960 RGDID:1304928 Length:333 Species:Rattus norvegicus


Alignment Length:291 Identity:74/291 - (25%)
Similarity:104/291 - (35%) Gaps:104/291 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 NGGGGGGSGAVLGGG-----------AVG-GSANGYY----GGYGGGYGTANGSVGSTHSQGHSP 235
            :|.||......||.|           |:| |.|..:|    ||||||.               ||
  Rat    75 SGPGGEARARALGLGPRPPPGPGPPFALGCGGATRWYPRAQGGYGGGL---------------SP 124

  Fly   236 HSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMS 300
            .:...|        .|.|...:|          |.|.|.|            ||...|:...:::
  Rat   125 DTSDRD--------SPETGEDMG----------RAESAWP------------RCPGPGAVPREVT 159

  Fly   301 EEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGME 365
            .:                     |.:...|: .||..:...          ||..|.|..:.|..
  Rat   160 TQ---------------------GPAAGGEE-AAELAEAPA----------VAAAAAGEARGGRR 192

  Fly   366 PKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKL--- 427
             |:.||.::|.|:.:||..|...|||:...|..:|.:|.|:|.|:||||||||.|||:....   
  Rat   193 -KKTRTVFSRSQVFQLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELE 256

  Fly   428 ------PNTKNVRKKTVDANGNPTPVAKKPT 452
                  |..:.:.:..|..:.:| |.|..||
  Rat   257 AASLSPPGAQRLVRVPVLYHESP-PAATGPT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 25/51 (49%)
Hmx1NP_001101833.2 Homeobox 195..249 CDD:395001 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.