DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and Lhx4

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001101818.2 Gene:Lhx4 / 360858 RGDID:1308044 Length:390 Species:Rattus norvegicus


Alignment Length:221 Identity:49/221 - (22%)
Similarity:88/221 - (39%) Gaps:46/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 DEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPGMEPKRQRTAYTRHQILELEKEFHYNRYLTR 393
            ||..:.|  ||..:    .|:.:.....|...:.|  .||.||..|..|:..|:..:..:....|
  Rat   128 DEFYLME--DGRLV----CKEDYETAKQNDDSEAG--AKRPRTTITAKQLETLKNAYKNSPKPAR 184

  Fly   394 RRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVRKKTVDANGNPTPVAKKPTKRA--A 456
            ..|.:::....|..|.:::||||||.|.|:..|            ||..:......|..||:  .
  Rat   185 HVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK------------DAGRHRWGQFYKSVKRSRGG 237

  Fly   457 SKKQQQAQQQQ---QSQQQQTQQTPVMNECIRSDSL-ESIGDVSSSL------------------ 499
            ||:::::..:.   ...:...::..:::|...::.: .::|||:...                  
  Rat   238 SKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDL 302

  Fly   500 --GNPPYIPAAPETTSSYPGSQQHLS 523
              |:|..||.:|.:.||.|.....||
  Rat   303 RDGSPYGIPQSPSSISSLPSHAPLLS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 16/51 (31%)
Lhx4NP_001101818.2 LIM1_Lhx4 30..81 CDD:188852
LIM2_Lhx3_Lhx4 89..144 CDD:188762 6/21 (29%)
Homeobox 160..214 CDD:395001 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.