DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and ap

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:208 Identity:44/208 - (21%)
Similarity:78/208 - (37%) Gaps:59/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 TANGSVGSTH---SQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQ 281
            ||:.|:.:|:   :|..|||:         .|:.|.::.:..:...|:        .|||...:.
  Fly   272 TASSSMSATYPYSAQFGSPHN---------DSSSPHSDPSRSIVPTGI--------FVPASHVIN 319

  Fly   282 ELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPW 346
            .|....|            ::.| ...|.|         .|:....::.||..|..|..|     
  Fly   320 GLPQPAR------------QKGR-PRKRKP---------KDIEAFTANIDLNTEYVDFGR----- 357

  Fly   347 MKKIHVAGVANGSY-QPGMEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQI 410
                       ||: ......||.||::..||:..::..|..|.....:...:::....|.:|.:
  Fly   358 -----------GSHLSSSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVL 411

  Fly   411 KIWFQNRRMKWKK 423
            ::||||.|.||::
  Fly   412 QVWFQNARAKWRR 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 14/51 (27%)
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeobox 371..424 CDD:395001 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.