DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dfd and EVX2

DIOPT Version :9

Sequence 1:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001073927.1 Gene:EVX2 / 344191 HGNCID:3507 Length:476 Species:Homo sapiens


Alignment Length:282 Identity:78/282 - (27%)
Similarity:106/282 - (37%) Gaps:78/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQG 232
            :|| ||.|    ....|.||..|    .|||                       .....|.|...
Human    16 LHS-PTAG----KRFSNLSNSAG----NAVL-----------------------EALENSQHPAR 48

  Fly   233 HSP-------HSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRI-EEAVPAGQQLQELGMRLRC 289
            .||       ||.:.:||   :..:...:|...||..|  .|..: .|...|.:..::.|   ..
Human    49 LSPRLPSAPLHSALGELP---AKGKFEIDTLFNLQHTG--SESTVSSEISSAAESRKKPG---HY 105

  Fly   290 DDMGSENDDMSE-EDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVA 353
            .:..:|.|..|: |......|||..||:....::.|...::....|.||..            .:
Human   106 SEAAAEADMSSDVEVGCSALRSPGGLGAAQLKENNGKGYAESGSAAGTTTS------------AS 158

  Fly   354 GVANGSYQPGM-----------------EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAH 401
            |...||...|.                 :.:|.|||:||.||..|||||:...|::|.||.|:|.
Human   159 GSGLGSLHGGSGGSGGSAALGGSGSGADQVRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAA 223

  Fly   402 TLVLSERQIKIWFQNRRMKWKK 423
            .|.|.|..||:||||||||.|:
Human   224 ALNLPETTIKVWFQNRRMKDKR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DfdNP_477201.1 Homeobox 370..422 CDD:278475 31/51 (61%)
EVX2NP_001073927.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..113 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..185 7/54 (13%)
Homeobox 192..244 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.